Analytical Data
-
Gene name
SPAST
- Application
-
Alternative Names
Spastic paraplegia 4 protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UBP0
-
Expression Region
317-616 aa
-
AA Sequence
FRNVDSNLANLIMNEIVDNGTAVKFDDIAGQDLAKQALQEIVILPSLRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAESNATFFNISAASLTSKYVGEGEKLVRALFAVARELQPSIIFIDEVDSLLCERREGEHDASRRLKTEFLIEFDGVQSAGDDRVLVMGATNRPQELDEAVLRRFIKRVYVSLPNEETRLLLLKNLLCKQGSPLTQKELAQLARMTDGYSGSDLTALAKDAALGPIRELKPEQVKNMSASEMRNIRLSDFTESLKKIKRSVSPQTLEAYIRWNKDFGDTTV
-
Molecular Weight
40.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SPAST (Spastin) is a crucial protein encoded by the SPAST gene, primarily associated with hereditary spastic paraplegia (HSP), a neurodegenerative disorder characterized by progressive weakness and stiffness of the lower limbs. The importance of SPAST lies in its role in the severing of microtubules, which are essential for proper neuronal function and axonal transport. Mutations in the SPAST gene disrupt these cellular processes, leading to the degeneration of motor neurons. Research on SPAST recombinant protein has gained momentum as it can serve as a valuable tool to elucidate the molecular mechanisms underlying HSP and aid in the development of therapeutic strategies. By producing and characterizing recombinant SPAST, researchers aim to better understand its functional domains, interactions with other cellular components, and the impact of specific mutations on its activity. Furthermore, studying the effects of SPAST dysfunction at the cellular level can provide insights into the broader implications of microtubule dynamics in neurodegenerative diseases. Thus, SPAST recombinant protein research stands at the intersection of molecular biology and clinical neuroscience, promising advancements in the understanding and potential treatment of HSP and similar conditions.
