Analytical Data
-
Gene name
CXXC4
- Application
-
Alternative Names
CXXC4；IDAX；CXXC-type zinc finger Protein 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H2H0
-
Expression Region
1-198aa
-
AA Sequence
MHHRNDSQRLGKAGCPPEPSLQMANTNFLSTLSPEHCRPLAGECMNKLKCGAAEAEIMNLPERVGTFSAIPALGGISLPPGVIVMTALHSPAAASAAVTDSAFQIANLADCPQNHSSSSSSSSGGAGGANPAKKKRKRCGVCVPCKRLINCGVCSSCRNRKTGHQICKFRKCEELKKKPGTSLERTPVPSAEAFRWFF
-
Molecular Weight
48.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CXXC4, also known as CXDC4 or CXXC-type zinc finger protein 4, has gained attention in recent years due to its potential involvement in various biological processes and diseases. This protein is characterized by its unique CXXC motif, which plays a crucial role in binding to zinc ions and is believed to modulate transcriptional activities. Research has demonstrated that CXXC4 may function as a regulator in cellular signaling pathways and could have implications in cancer biology, particularly in influencing the proliferation and apoptosis of tumor cells. Additionally, studies suggest that CXXC4 might be involved in the regulation of gene expression related to differentiation and immune responses, highlighting its potential role in developmental biology and autoimmune diseases. Given its multifaceted roles, the investigation of CXXC4 as a recombinant protein has become a focus, enabling scientists to explore its structure-function relationships and interactions with other cellular components. Such studies may also facilitate the development of therapeutic strategies targeting CXXC4-related pathways, offering new avenues for treating diseases where this protein plays a critical role. Understanding the mechanisms of CXXC4 could enhance our knowledge of its physiological functions and provide insights into its potential as a biomarker or therapeutic target in various health conditions.
