Analytical Data
-
Gene name
GPER
- Application
-
Alternative Names
GPER；CEPR；CMKRL2；DRY12；G-Protein coupled estrogen receptor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99527
-
Expression Region
1-375aa
-
AA Sequence
MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLHERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRVLVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPER (G protein-coupled estrogen receptor) is a member of the G protein-coupled receptor family that has garnered significant interest in recent years for its role in mediating the rapid effects of estrogens in various tissues. Unlike the classical estrogen receptors (ERα and ERβ), GPER is predominantly localized in the cell membrane, allowing it to initiate signaling cascades that can impact cell function almost instantaneously. Research into GPER has revealed its involvement in numerous physiological processes, including cardiovascular health, neural function, and reproductive biology. Additionally, GPER has been implicated in the pathophysiology of various diseases, including cancer, where its expression levels can influence tumor progression and response to therapies. Recent advancements in recombinant protein technology have enabled researchers to produce and study GPER in more detail, providing insights into its structure, function, and potential as a therapeutic target. These studies are crucial for understanding the receptor’s signaling mechanisms and exploring its potential implications in disease treatment and prevention, paving the way for innovative approaches in pharmacology and personalized medicine.
