Analytical Data
-
Gene name
GPR109B
- Application
-
Alternative Names
GPR109B；GPR109B；HCA3；HM74B；Hydroxycarboxylic acid receptor 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49019
-
Expression Region
1-387aa
-
AA Sequence
MNRHHLQDHFLEIDKKNCCVFRDDFIAKVLPPVLGLEFIFGLLGNGLALWIFCFHLKSWKSSRIFLFNLAVADFLLIICLPFVMDYYVRRSDWKFGDIPCRLVLFMFAMNRQGSIIFLTVVAVDRYFRVVHPHHALNKISNWTAAIISCLLWGITVGLTVHLLKKKLLIQNGTANVCISFSICHTFRWHEAMFLLEFFLPLGIILFCSARIIWSLRQRQMDRHAKIKRAITFIMVVAIVFVICFLPSVVVRIHIFWLLHTSGTQNCEVYRSVDLAFFITLSFTYMNSMLDPVVYYFSSPSFPNFFSTLINRCLQRKITGEPDNNRSTSVELTGDPNKTRGAPEALIANSGEPWSPSYLGPTSNNHSKKGHCHQEPASLEKQLGCCIE
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPR109B, a member of the G protein-coupled receptor (GPCR) family, has garnered attention due to its significant role in lipid metabolism and its involvement in physiological processes such as inflammation and immune responses. Discovered as a receptor for niacin, GPR109B is primarily expressed in immune cells and adipose tissues, suggesting its potential impact on metabolic disorders and inflammatory diseases. The receptor's activation has been linked to beneficial effects, including the reduction of atherosclerosis and modulation of cholesterol levels, making it a potential therapeutic target for conditions like cardiovascular disease and obesity. However, research on GPR109B has been limited by the challenges of obtaining the protein in a functional form for detailed studies. Recombinant protein expression techniques have become crucial for elucidating the structural and functional characteristics of GPR109B, providing insights into its signaling pathways and physiological roles. Understanding the mechanisms by which GPR109B operates may pave the way for novel interventions in metabolic and inflammatory diseases, ultimately contributing to better healthcare strategies.
