Analytical Data
-
Gene name
DDX19
- Application
-
Alternative Names
ATP dependent RNA helicase DDX19A; ATP-dependent RNA helicase DDX19A; DD19A_HUMAN; DDX19 like protein; DDX19-like protein; DDX19A; DDX19L; DEAD box protein 19A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UMR2
-
Expression Region
1-479aa
-
AA Sequence
MATDSWALAVDEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN
-
Molecular Weight
78.43 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DDX19, also known as DEAD-box helicase 19, is a member of the DEAD-box RNA helicase family, playing critical roles in various cellular processes including RNA metabolism, translation initiation, and ribosome biogenesis. The significance of DDX19 in cellular function and its potential implications in cancer and viral infections have sparked research interest. It is known to facilitate the export of RNA from the nucleus to the cytoplasm, a process vital for gene expression regulation. Studies have shown that DDX19 interacts with several RNA-binding proteins and is involved in the maintenance of cellular homeostasis. Additionally, aberrations in DDX19 expression levels have been linked to the progression of multiple cancer types, making it a potential target for therapeutic intervention. The development of recombinant DDX19 protein allows for detailed investigations into its biochemical properties and interactions at the molecular level, providing insight into its functional dynamics. By studying the structure and mechanisms of DDX19 in vitro and in vivo, researchers aim to elucidate its role in disease pathogenesis and explore its potential as a biomarker or therapeutic target. Thus, recombinant DDX19 protein research not only enhances our understanding of fundamental cellular processes but also opens avenues for innovative strategies in disease management.
