Analytical Data
-
Gene name
MDM2
- Application
-
Alternative Names
MDM2;E3 ubiquitin-Protein ligase Mdm2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q00987-11
-
Expression Region
1-118aa
-
AA Sequence
MHHHHHHGSMCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSV GAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSF SVKEHRKIYTMIYRNLVVVNQQESSDS
-
Molecular Weight
18 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MDM2 (mouse double minute 2 homolog) is a pivotal oncogene that encodes an E3 ubiquitin ligase responsible for regulating the p53 tumor suppressor pathway. Elevated levels of MDM2 have been implicated in various cancers, as it facilitates the ubiquitination and subsequent degradation of p53, thus hindering its ability to initiate cell cycle arrest and apoptosis in response to genotoxic stress. Research on MDM2 has gained momentum due to its critical role in tumorigenesis and the development of resistance to chemotherapy. The recombinant MDM2 protein is essential for studying its structural and functional properties, interactions with p53, and the mechanisms by which it modulates cellular responses to stress. Furthermore, MDM2 is a promising target for novel therapeutic strategies, such as small-molecule inhibitors that can restore p53 function and induce apoptosis in cancer cells. Understanding the biophysical characteristics and functional dynamics of recombinant MDM2 can pave the way for innovative approaches in cancer treatment, making it a significant focus in molecular biology and oncology research.











