Cat: PA1000-7815

Recombinant Human MDM2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MDM2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MDM2;E3 ubiquitin-Protein ligase Mdm2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q00987-11

  • Expression Region

    1-118aa

  • AA Sequence

    MHHHHHHGSMCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSV GAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVYCSNDLLGDLFGVPSF SVKEHRKIYTMIYRNLVVVNQQESSDS

  • Molecular Weight

    18 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MDM2 (mouse double minute 2 homolog) is a pivotal oncogene that encodes an E3 ubiquitin ligase responsible for regulating the p53 tumor suppressor pathway. Elevated levels of MDM2 have been implicated in various cancers, as it facilitates the ubiquitination and subsequent degradation of p53, thus hindering its ability to initiate cell cycle arrest and apoptosis in response to genotoxic stress. Research on MDM2 has gained momentum due to its critical role in tumorigenesis and the development of resistance to chemotherapy. The recombinant MDM2 protein is essential for studying its structural and functional properties, interactions with p53, and the mechanisms by which it modulates cellular responses to stress. Furthermore, MDM2 is a promising target for novel therapeutic strategies, such as small-molecule inhibitors that can restore p53 function and induce apoptosis in cancer cells. Understanding the biophysical characteristics and functional dynamics of recombinant MDM2 can pave the way for innovative approaches in cancer treatment, making it a significant focus in molecular biology and oncology research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US