Analytical Data
-
Gene name
SNX25
- Application
-
Alternative Names
MSTP043; SBBI31; SNX25; SNX25_HUMAN; Sorting nexin-25
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H3E2
-
Expression Region
1-483 aa
-
AA Sequence
MYMERMDKRALISFWESVEHLKNANKNEIPQLVGEIYQNFFVESKEISVEKSLYKEIQQCLVGNKGIEVFYKIQEDVYETLKDRYYPSFIVSDLYEKLLIKEEEKHASQMISNKDEMGPRDEAGEEAVDDGTNQINEQASFAVNKLRELNEKLEYKRQALNSIQNAPKPDKKIVSKLKDEIILIEKERTDLQLHMARTDWWCENLGMWKASITSGEVTEENGEQLPCYFVMVSLQEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDQKFMEKSKNQLNKFLQEETEEDSDLSDYGDDVDGRKDALAEPCFMLIGEIFELRGMFKWVRRTLIALVQVTFGRTINKQIRDTVSWIFSEQMLVYYINIFRDAFWPNGKLAPPTTIRSKEQSQETKQRAQQKLLENIPDMLQSLVGQQNARHGIIKIFNALQETRANKHLLYALMELLLIELCPELRVHLDQLKAGQV
-
Molecular Weight
78.87 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SNX25 (Sorting Nexin 25) is a member of the sorting nexin family, which plays a crucial role in intracellular trafficking and endosomal recycling processes. This protein is involved in the regulation of membrane dynamics and the sorting of proteins within the endocytic pathway, influencing diverse cellular functions including signal transduction, receptor recycling, and nutrient uptake. Recent studies have indicated that SNX25 may be implicated in various physiological and pathological conditions, including cancer, neurodegenerative diseases, and metabolic disorders. The interest in SNX25 recombination protein stems from its potential as a therapeutic target and its role in disease mechanisms. By understanding the structure-function relationship of SNX25 through recombinant protein studies, researchers can elucidate its specific interactions with other cellular components and pathways. Furthermore, characterizing SNX25 as a recombinant protein allows for detailed biochemical analyses, including affinity binding assays and functional assays in cellular models. This knowledge could pave the way for novel approaches to modulate SNX25 activity, offering insights into its involvement in disease processes and potentially leading to innovative therapeutic strategies. As the field of targeted therapy expands, the study of SNX25 presents an exciting opportunity to unlock new avenues for intervention in diseases where its function is disrupted.











