Analytical Data
-
Gene name
DCUN1D5
- Application
-
Alternative Names
DCUN1D5DCN1-like protein 5; DCUN1 domain-containing protein 5; Defective in cullin neddylation protein 1-like protein 5
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BTE7
-
Expression Region
1-237aa
-
AA Sequence
MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWFYEYAGPDEVVGPEGMEKFCEDIGVEPENIIMLVLAWKLEAESMGFFTKEEWLKGMTSLQCDCTEKLQNKFDFLRSQLNDISSFKNIYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHADLSNYDEDGAWPVLLDEFVEWQKVRQTS
-
Molecular Weight
53.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DCUN1D5, a member of the DCUN1D protein family, is implicated in various cellular processes, primarily associated with the ubiquitin-proteasome system, which governs protein degradation and turnover. Research interests surrounding DCUN1D5 have surged due to its potential role in modulating protein homeostasis and contributing to disease mechanisms, particularly in cancer and neurodegenerative disorders. Initial studies suggest that DCUN1D5 may influence the stability and activity of key regulatory proteins, thereby affecting cell cycle progression and apoptosis. Given the importance of ubiquitin-mediated degradation in maintaining cellular health, understanding the precise molecular functions of DCUN1D5 could unveil novel therapeutic targets. Furthermore, its interactions with E3 ubiquitin ligases and potential involvement in protein quality control pathways position DCUN1D5 as a critical component in the study of proteostasis. As research advances, elucidating the specific mechanisms by which DCUN1D5 operates might provide insights into its roles in various pathological conditions, highlighting the significance of this protein in fundamental biological processes.
