Analytical Data
-
Gene name
Efhd2
- Application
-
Alternative Names
Efhd2；SWS1；EF-hand domain-containing Protein D2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96C19
-
Expression Region
1-240aa
-
AA Sequence
MATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGS ADCELSAKLLRRADLNQGIGEPQSPSRRVFNPYTEFKEFSRKQIKDMEKM FKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKNMIKEVDEDFDSKLSF REFLLIFRKAAAGELQEDSGLCVLARLSEIDVSSEGVKGAKSFFEAKVQA INVSSRFEEEIKAEQEERKKQAEEMKQRKAAFKELQSTFK
-
Molecular Weight
53 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EFHD2 (EF-hand domain-containing protein 2) is a calcium-binding protein that plays a significant role in various cellular processes, including cell signaling, apoptosis, and muscle contraction. The interest in EFHD2 has grown due to its involvement in neurodegenerative diseases and its potential implications in muscle disorders. Researchers have identified that EFHD2 interacts with other proteins and cellular components, suggesting it might serve as a critical regulator in calcium homeostasis and signal transduction pathways. The study of recombinant EFHD2 protein is vital for elucidating its structural and functional characteristics, which may lead to better understanding of its role in health and disease. By producing EFHD2 as a recombinant protein, scientists aim to explore its biochemical properties, investigate its interactions with other proteins, and assess its effects under various physiological conditions. This knowledge could pave the way for developing targeted therapies for conditions associated with EFHD2 dysregulation, thereby contributing to advancements in biomedical research and treatment strategies.
