Analytical Data
-
Gene name
ELAVL1
- Application
-
Alternative Names
ELAVL1；HUR；ELAV-like Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15717
-
Expression Region
1-362aa
-
AA Sequence
MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAK LIRDKVAGHSLGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSYARPSS EVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVDQTTGLSRGVA FIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANPNQNKNVALLSQLY HSPARRFGGPVHHQAQRFRFSPMGVDHMSGLSGVNVPGNASSGWCIFIYN LGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAM AIASLNGYRLGDKILQVSFKTNKSHK
-
Molecular Weight
63 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ELAVL1, also known as HuR, is an RNA-binding protein that plays a pivotal role in post-transcriptional regulation of gene expression. It is involved in the stabilization of mRNA, influencing processes such as mRNA transport, translation, and degradation. ELAVL1 is critical in various cellular processes, including proliferation, differentiation, and stress responses. Its dysregulation is implicated in several diseases, notably cancer and neurodegenerative disorders, making it a significant target for therapeutic interventions. Research on ELAVL1 recombinant proteins has garnered attention due to their potential applications in understanding these regulatory mechanisms and developing novel treatments. By producing ELAVL1 as a recombinant protein, scientists can investigate its specific interactions with RNA and other protein partners, elucidating its function in cellular contexts. Additionally, studying ELAVL1's structure and dynamics can provide insights into how it recognizes and binds to target mRNAs, as well as how post-translational modifications affect its activity. This research not only contributes to the fundamental understanding of gene expression regulation but also aids in the identification of ELAVL1 as a biomarker for disease progression and prognosis. Overall, the study of ELAVL1 recombinant protein serves as a crucial step in unraveling the complexities of mRNA regulation and its implications in health and disease.
