Analytical Data
-
Gene name
DCAL1
- Application
-
Alternative Names
CLECL1P. CLECL1. DCAL1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IZS7
-
Expression Region
82-167aa
-
AA Sequence
DVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAKDWKVHKGKCYWIAETKKSWNKSQNDCAINNSYLMVIQDITAMVRFNI
-
Molecular Weight
35.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DCAL1 (Dipeptidyl Peptidase-Like Protein 1) is a member of the DPP (Dipeptidyl Peptidase) family, which is involved in various biological processes, including proteolysis, signal transduction, and immune responses. Recent studies have highlighted the significance of DCAL1 due to its potential role in diseases, including cancer and metabolic disorders. The interest in DCAL1 recombinant proteins has surged, as they can provide valuable insights into its physiological functions and pathological implications. Recombinant expression systems allow for the efficient production of DCAL1, enabling researchers to study its biochemical properties, substrate specificity, and interaction with other proteins. Furthermore, the availability of DCAL1 in a purified form facilitates the exploration of its functional role in cellular contexts and the potential for therapeutic applications. Understanding the mechanisms underlying DCAL1’s activity may lead to novel strategies for disease intervention and the development of biomarker assays. As such, the ongoing investigation into DCAL1 recombinant proteins represents a promising frontier in biochemistry and medicine, emphasizing the need for continued research in this field.











