Analytical Data
-
Gene name
RB1CC1
- Application
-
Alternative Names
RB1CC1;KIAA0203;RBICC;RB1-inducible coiled-coil Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TDY2
-
Expression Region
1241-1594aa
-
AA Sequence
AIQTALKEFKLEREVVEKELLEKVKHLENQIAKSPAIDSTRGDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNVRTSLIAEQQTNFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLEEKKKLEEEVSKLRSSSFVPSPYVATAPELYGACAPELPGESDRSAVETADEGRVDSAMETSMMSVQENIHMLSEEKQRIMLLERTLQLKEEENKRLNQRLMSQSMSSVSSRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV
-
Molecular Weight
47.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RB1CC1, also known as RCC1 or FIP200, is a critical protein that plays a pivotal role in various cellular processes, including autophagy, cell growth, and survival. It functions as a regulatory subunit that interacts with the mTOR (mechanistic target of rapamycin) signaling pathway, which is integral for cellular metabolism and homeostasis. Recent studies have highlighted the significance of RB1CC1 in cancer biology, particularly its involvement in tumorigenesis and the response to therapeutic interventions. The protein's role in autophagy has garnered attention, as autophagy is a crucial mechanism for maintaining cellular integrity and function under stress conditions. In addition to its relevance in cancer, RB1CC1 has been linked to developmental disorders and neurodegenerative diseases, underscoring its importance in various biological contexts. The exploration of RB1CC1 as a recombinant protein has opened new avenues for understanding its structure-function relationships and developing potential therapeutic strategies aimed at modulating its activity. By characterizing RB1CC1 through recombinant protein techniques, researchers aim to elucidate its molecular mechanisms and interactions within the cell, paving the way for innovative approaches to treat diseases associated with its dysregulation.











