Analytical Data
-
Gene name
SLCO2A1
- Application
-
Alternative Names
SLCO2A1; OATP2A1; SLC21A2; Solute carrier organic anion transporter family member 2A1; Prostaglandin transporter; PGT; Solute carrier family 21 member 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92959
-
Expression Region
276-325 aa
-
AA Sequence
FFFPRAMPIGAKRAPATADEARKLEEAKSRGSLVDFIKRFPCIFLRLLMN
-
Molecular Weight
31.24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLCO2A1, a member of the solute carrier organic anion transporter (SLCO) family, plays a significant role in the transport of steroid hormones and pharmaceutical compounds across cellular membranes. Its involvement in the uptake of prostaglandins and steroid sulfates highlights its potential influence on various physiological processes, including inflammation, reproductive functions, and drug metabolism. Dysregulation of SLCO2A1 has been implicated in several pathological conditions, such as cancer and cardiovascular diseases. Consequently, research into SLCO2A1 recombinant protein is crucial for understanding its functional mechanisms and interactions with other biomolecules. Generating recombinant SLCO2A1 can facilitate studies on substrate specificity, transport kinetics, and potential pharmacological applications, contributing to the development of targeted therapies. Additionally, elucidating the structural and functional properties of SLCO2A1 through biochemical assays can provide valuable insights into its role in health and disease, thus enhancing our understanding of its therapeutic potential.
