Analytical Data
-
Gene name
CD52
- Application
-
Alternative Names
CD52；CDW52；HE5；CAMPATH-1 antigen
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P31358
-
Expression Region
25-36aa
-
AA Sequence
GQNDTSQTSSPSLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLM ISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP PSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHH H
-
Molecular Weight
28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD52 is a small glycoprotein predominantly expressed on the surface of lymphocytes, including T and B cells, and is involved in immune regulation. The research surrounding CD52 has gained significant attention due to its potential implications in therapeutic interventions for various autoimmune diseases and hematological malignancies. One of the notable developments in this field has been the creation of recombinant forms of CD52, which serve as crucial tools for understanding its biological function and for therapeutic applications. For instance, the humanized monoclonal antibody alemtuzumab, which targets CD52, has been successfully used to treat chronic lymphocytic leukemia (CLL) and multiple sclerosis (MS). Studies have demonstrated that CD52 interacts with various immune cells, leading to the depletion of T and B lymphocytes, enhancing the understanding of the mechanisms underlying immune system modulation. Furthermore, the exploration of CD52 as a potential target for immunotherapy has opened new avenues for research, especially in creating novel treatments that leverage CD52's expression patterns to selectively target diseased cells while preserving healthy tissues. Overall, the ongoing research into CD52 recombinant proteins not only contributes to the fundamental knowledge of immune cell biology but also holds promise for innovative therapeutic strategies in both oncology and autoimmune disorders.
