Analytical Data
-
Gene name
CYP4X1
- Application
-
Alternative Names
CYP4X1; UNQ1929/PRO4404; Cytochrome P450 4X1; CYPIVX1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N118
-
Expression Region
1-509aa
-
AA Sequence
MEFSWLETRWARPFYLAFVFCLALGLLQAIKLYLRRQRLLRDLRPFPAPPTHWFLGHQKFIQDDNMEKLEEIIEKYPRAFPFWIGPFQAFFCIYDPDYAKTLLSRTDPKSQYLQKFSPPLLGKGLAALDGPKWFQHRRLLTPGFHFNILKAYIEVMAHSVKMMLDKWEKICSTQDTSVEVYEHINSMSLDIIMKCAFSKETNCQTNSTHDPYAKAIFELSKIIFHRLYSLLYHSDIIFKLSPQGYRFQKLSRVLNQYTDTIIQERKKSLQAGVKQDNTPKRKYQDFLDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNPEHQERCREEVRGILGDGSSITWDQLGEMSYTTMCIKETCRLIPAVPSISRDLSKPLTFPDGCTLPAGITVVLSIWGLHHNPAVWKNPKVFDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVTPDPTRPLTFPNHFILKPKNGMYLHLKKLSEC
-
Molecular Weight
81.51 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CYP4X1 is a member of the cytochrome P450 enzyme family, which plays a crucial role in the metabolism of a wide range of endogenous and exogenous compounds, including drugs and fatty acids. Research on CYP4X1 has gained attention due to its potential implications in pharmacogenomics and toxicology. Unlike other P450 enzymes, CYP4X1 is primarily expressed in the liver and the brain, suggesting a specialized role in metabolic processes in these tissues. Genetic variations in CYP4X1 have been linked to differences in drug response and susceptibility to certain diseases, highlighting the importance of understanding its functional characteristics. Recombinant protein studies of CYP4X1 are essential for elucidating its substrate specificity, enzymatic activity, and regulation. The production of CYP4X1 as a recombinant protein allows researchers to investigate its role in drug metabolism and interaction pathways in a controlled environment, shedding light on its physiological functions and potential therapeutic targets. Furthermore, studying CYP4X1 may contribute to the development of personalized medicine approaches, where genetic variations can be accounted for in treatment decisions. Overall, the study of CYP4X1 recombinant protein is significant for advancing our knowledge of P450 enzymes and their impact on human health.
