Analytical Data
-
Gene name
CYP4V2
- Application
-
Alternative Names
CYP4V2; Cytochrome P450 4V2; Docosahexaenoic acid omega-hydroxylase CYP4V2; Long-chain fatty acid omega-monooxygenase
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6ZWL3
-
Expression Region
1-525aa
-
AA Sequence
MAGLWLGLVWQKLLLWGAASALSLAGASLVLSLLQRVASYARKWQQMRPIPTVARAYPLVGHALLMKPDGREFFQQIIEYTEEYRHMPLLKLWVGPVPMVALYNAENVEVILTSSKQIDKSSMYKFLEPWLGLGLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEKHINQEAFNCFFYITLCALDIICETAMGKNIGAQSNDDSEYVRAVYRMSEMIFRRIKMPWLWLDLWYLMFKEGWEHKKSLKILHTFTNSVIAERANEMNANEDCRGDGRGSAPSKNKRRAFLDLLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHFWIESNQKREELGLEGQLILRPSNGIWIKLKRRNADER
-
Molecular Weight
87.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CYP4V2 is a member of the cytochrome P450 superfamily, which plays a crucial role in the metabolism of various endogenous and exogenous compounds. This enzyme is primarily expressed in the liver and has been implicated in the biotransformation of fatty acids and drug metabolism. Recent research has highlighted the significance of CYP4V2 in the context of certain diseases, particularly in the development of systemic conditions like Bietti crystalline corneoretinal dystrophy (BCD), a genetic disorder characterized by visual impairment and retinal degeneration. Mutations in the CYP4V2 gene have been linked to the accumulation of lipids in ocular tissues, leading to the symptoms associated with BCD. The study of recombinant CYP4V2 protein has become increasingly important for understanding its enzymatic functions, substrate specificity, and the molecular mechanisms underlying its association with retinal dystrophies. By producing and characterizing recombinant CYP4V2, researchers aim to elucidate its role in lipid metabolism and its potential as a therapeutic target for related disorders. Additionally, the investigation of CYP4V2 activity could provide insights into its contribution to drug metabolism and toxicity, enhancing our understanding of individual variations in drug response and advancing personalized medicine approaches. Overall, the research on recombinant CYP4V2 protein not only sheds light on its biological significance but also opens avenues for potential therapeutic interventions in diseases linked to its dysfunction.











