Cat: PA2000-3333

Recombinant Human MLKL Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MLKL

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MLKL;Mixed lineage kinase domain-like Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8NB16

  • Expression Region

    1-471aa

  • AA Sequence

    MENLKHIITLGQVIHKRCEEMKYCKKQCRRLGHRVLGLIKPLEMLQDQGK RSVPSEKLTTAMNRFKAALEEANGEIEKFSNRSNICRFLTASQDKILFKD VNRKLSDVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQM LRRDNEKIEASLRRLEINMKEIKETLRQYLPPKCMQEIPQEQIKEIKKEQ LSGSPWILLRENEVSTLYKGEYHRAPVAIKVFKKLQAGSIAIVRQTFNKE IKTMKKFESPNILRIFGICIDETVTPPQFSIVMEYCELGTLRELLDREKD LTLGKRMVLVLGAARGLYRLHHSEAPELHGKIRSSNFLVTQGYQVKLAGF ELRKTQTSMSLGTTREKTDRVKSTAYLSPQELEDVFYQYDVKSEIYSFGI VLWEIATGDIPFQGCNSEKIRKLVAVKRQQEPLGEDCPSELREIIDECRA HDPSVRPSVDEILKKLSTFSK

  • Molecular Weight

    59 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MLKL (Mixed Lineage Kinase Domain-Like Protein) is a crucial effector in the pathway of programmed necrosis, particularly in the context of necroptosis, a form of regulated cell death distinct from apoptosis. Initially identified as a key player in the TNF receptor signaling cascade, MLKL is activated through phosphorylation by the kinases RIPK1 and RIPK3, leading to its oligomerization and subsequent translocation to the plasma membrane. This process disrupts cellular integrity and triggers inflammation, marking its role in various pathological conditions, including neurodegenerative diseases, inflammatory disorders, and cancer. Given its significance in necroptosis, researchers have focused on elucidating the molecular mechanisms governing MLKL function and the implications of its activity in disease contexts. Advances in structural biology have facilitated the characterization of MLKL's oligomeric states and provided insights into its interaction with lipid membranes, which are critical for understanding its role in cell death and inflammation. The development of MLKL inhibitors has emerged as a promising therapeutic strategy to modulate necroptosis, potentially offering avenues for treating diseases where this process is dysregulated. Hence, the study of MLKL, particularly through recombinant protein techniques, is pivotal for both basic biological research and the development of innovative treatments targeting necroptosis-related pathologies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US