Analytical Data
-
Gene name
CHCHD4
- Application
-
Alternative Names
CHCHD4；MIA40；Mitochondrial intermembrane space import and assembly Protein 40
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N4Q1
-
Expression Region
1-142aa
-
AA Sequence
MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNINWNCPCLGGMASGPCGEQFKSAFSCFHYSTEEIKGSDCVDQFRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGSS
-
Molecular Weight
32.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CHCHD4, a member of the CHCHD (coiled-coil-helix-coiled-coil-helix domain) protein family, is known for its critical role in mitochondrial biology and cellular metabolism. It contains a conserved coiled-coil domain that facilitates interactions with other proteins and may be involved in the regulation of mitochondrial dynamics and apoptosis. Recent studies have highlighted CHCHD4's involvement in various physiological processes, including the response to oxidative stress and maintenance of mitochondrial integrity. Moreover, there is growing interest in understanding CHCHD4's implications in disease, particularly in cancer, where its altered expression has been linked to tumor progression and metastasis. The recombinant expression of CHCHD4 in model systems allows for detailed investigations into its structure-function relationships, interactions with other mitochondrial proteins, and potential as a therapeutic target. As researchers continue to explore the multifaceted roles of CHCHD4, the generation of recombinant CHCHD4 protein is essential for elucidating its biological activities and understanding its contributions to both normal cellular function and disease pathology.
