Cat: PA1000-7745

Recombinant Human SCUBE3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SCUBE3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SCUBE3;CEGF3;Signal peptide. CUB and EGF-like domain-containing Protein 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8IX30

  • Expression Region

    804-916aa

  • AA Sequence

    CGGELGEFTGYIESPNYPGNYPAGVECIWNINPPPKRKILIVVPEIFLPSEDECGDVLVMRKNSSPSSITTYETCQTYERPIAFTARSRKLWINFKTSEANSARGFQIPYVTY

  • Molecular Weight

    20.2 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SCUBE3 (Signal Sequence-Cub Domain-Containing EGF-Like 3) is a member of the SCUBE protein family, which is characterized by the presence of signal peptide, CUB (Complement C1r/C1s, Uegf, Bmp1) domains, and EGF-like repeats. It plays a significant role in various biological processes, including cell adhesion, migration, and signaling pathways, particularly in the context of cellular communication and development. Research into SCUBE3 has gained interest due to its involvement in pathophysiological conditions, such as cancer progression and cardiovascular diseases. Its expression has been linked to the regulation of key signaling pathways, including the Hedgehog and TGF-β pathways, which are crucial for embryonic development and tissue homeostasis. Furthermore, SCUBE3 has shown potential as a biomarker for certain cancers, highlighting its importance in tumorigenesis and metastasis. The recombinant expression of SCUBE3 can facilitate functional studies and structural analyses that help elucidate its roles and mechanisms in health and disease. Understanding SCUBE3's biological functions and interactions could provide novel insights into therapeutic strategies for diseases where its dysregulation is implicated, making it a promising target for future research in molecular biology and medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US