Analytical Data
-
Gene name
SLC46A2
- Application
-
Alternative Names
SLC46A2; TSCOT; Thymic stromal cotransporter homolog; Solute carrier family 46 member 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BY10
-
Expression Region
1-475 aa
-
AA Sequence
MSPEVTCPRRGHLPRFHPRTWVEPVMASSQVAASLYDAGLLLVVKASYGTGGSSNHSASPSPRGALEDQQQRAISNFYIIYNLVVGLSPLLSAYGLGWLSDRYHRKISICMSLLGFLLSRLGLLLKVLLDWPVEVLYGAAALNGLFGGFSAFWSGVMALGSLGSSEGRRSVRLILIDLMLGLAGFCGSMASGHLFKQMAGHSGQGLILTACSVSCASFALLYSLLVLKVPESVAKPSQELPAVDTVSGTVGTYRTLDPDQLDQQYAVGHPPSPGKAKPHKTTIALLFVGAIIYDLAVVGTVDVIPLFVLREPLGWNQVQVGYGMAAGYTIFITSFLGVLVFSRCFRDTTMIMIGMVSFGSGALLLAFVKETYMFYIARAVMLFALIPVTTIRSAMSKLIKGSSYGKVFVILQLSLALTGVVTSTLYNKIYQLTMDMFVGSCFALSSFLSFLAIIPISIVAYKQVPLSPYGDIIEK
-
Molecular Weight
77.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC46A2, also known as the solute carrier family 46 member 2, is a vital transporter protein that plays a crucial role in the absorption of folate, particularly in the intestines and kidneys. This protein is responsible for the cellular uptake of reduced folates and is important for various physiological processes, including DNA synthesis and repair, as well as amino acid metabolism. Research has identified that mutations in the SLC46A2 gene can lead to disorders such as hereditary folate malabsorption, characterized by symptoms such as megaloblastic anemia and neurological deficits. Given the essential role of folate in specific populations, particularly pregnant women and individuals with malabsorption syndromes, understanding the function and regulation of SLC46A2 is of significant clinical importance. Recombinant SLC46A2 protein has been utilized in studies to explore its binding characteristics, transport mechanisms, and interactions with different folate derivatives as well as potential pharmacological agents. These studies aim to elucidate the molecular basis of folate transport and contribute to developing therapeutic strategies for conditions related to folate deficiency. Advances in this field may also provide insights into the broader implications of folate transport in health and disease, influencing nutritional guidelines and intervention methods for at-risk populations. Overall, SLC46A2 remains a focal point of research in understanding folate metabolism and its impact on human health, showcasing the importance of transporter proteins in nutrient absorption and overall well-being.
