Analytical Data
-
Gene name
RAD50
- Application
-
Alternative Names
RAD50；DNA repair Protein RAD50
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92878
-
Expression Region
1-235aa
-
AA Sequence
MSRIEKMSILGVRSFGIEDKDKQIITFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPGTKGNTFVHDPKVAQETDVRAQIRLQFRDVNGELIAVQRSMVCTQKSKKTEFKTLEGVITRTKHGEKVSLSSKCAEIDREMISSLGVSKAVLNNVIFCHQEDSNWPLSEGKALKQKFDEIFSATRYIKALETLRQVRQTQGQKVKEYQMELKYLKQYKEKACEIRDQITSKEAQLT
-
Molecular Weight
34.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RAD50 is a crucial component of the MRE11-RAD50-NBS1 (MRN) complex, which plays a significant role in the cellular response to DNA double-strand breaks (DSBs), a type of severe DNA damage that can lead to genomic instability and cancer if not properly repaired. The MRN complex is pivotal for sensing DNA damage, facilitating its repair through homologous recombination, and maintaining genomic integrity. RAD50, in particular, is essential for the recruitment of repair proteins to sites of DSBs and is involved in the activation of ATM (Ataxia Telangiectasia Mutated) kinase, a key regulator of the DNA damage response pathway. Recent studies have highlighted the importance of RAD50 not only in normal cellular function but also in the context of various cancers, where mutations or dysregulation of RAD50 may contribute to tumorigenesis and resistance to conventional therapies. Understanding RAD50's structure and function, as well as its interactions within the MRN complex and with other cellular factors, has significant implications for developing targeted cancer therapies and enhancing our understanding of the molecular mechanisms underlying DNA repair processes. This research aims to elucidate RAD50's role in maintaining genomic stability and its potential as a therapeutic target in cancer treatment.
