Analytical Data
-
Gene name
DARC
- Application
-
Alternative Names
DARC；DARC；FY；GPD；Atypical chemokine receptor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16570
-
Expression Region
1-336aa
-
AA Sequence
MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The DARC (Duffy Antigen/Receptor for Chemokines) protein is a critical player in various physiological and pathological processes, particularly in the immune response and hematopoiesis. Originally identified as a blood group antigen, DARC is a chemokine receptor that binds to a range of chemokines, influencing the migration and activation of immune cells. Its role extends to modulating inflammation, tissue repair, and even mediating the infiltration of leukocytes during immune responses. Recent studies have also highlighted its significance in diseases such as malaria and certain cancers, where DARC expression can affect disease susceptibility and progression. The research surrounding DARC involves understanding its structural characteristics, binding mechanisms, and the signaling pathways it influences. Additionally, the development of DARC recombinant proteins has opened new avenues for therapeutic applications, including targeted drug delivery and immunotherapy. The exploration of DARC's functional diversity is essential for uncovering its potential in clinical settings, paving the way for innovative strategies in disease management and treatment.
