Analytical Data
-
Gene name
CYB5
- Application
-
Alternative Names
CYB5A; CYB5; Cytochrome b5; Microsomal cytochrome b5 type A; MCB5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P00167
-
Expression Region
1-134aa
-
AA Sequence
MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED
-
Molecular Weight
15.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Cytochrome b5 (CYB5) is a hemoprotein that plays a crucial role in various biological processes, including electron transport, lipid metabolism, and drug metabolism. It is found in both prokaryotic and eukaryotic organisms, suggesting its evolutionary significance. The study of recombinant CYB5 has gained momentum due to its potential applications in biotechnology and medicine. By using recombinant DNA technology, researchers can produce CYB5 in large quantities, allowing for detailed biochemical characterization and functional studies. Additionally, recombinant CYB5 can be utilized as a cofactor in enzyme reactions, enhancing the activity and specificity of drug-metabolizing enzymes like cytochrome P450s. Understanding the structural and functional properties of recombinant CYB5 can illuminate its interactions within metabolic pathways and provide insights into its role in health and disease. This research not only contributes to basic biological knowledge but also holds promise for developing novel therapeutic strategies and improving drug efficacy. The increasing demand for sustainable and efficient biocatalysts makes the investigation of recombinant CYB5 particularly relevant in the context of green chemistry and biomanufacturing. Thus, the exploration of CYB5's recombinant forms is a vital area of study that bridges basic research and practical applications.
