Analytical Data
-
Gene name
E2F2
- Application
-
Alternative Names
E2F2；Transcription factor E2F2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96ID7
-
Expression Region
1-83aa
-
AA Sequence
MESRSVAQAGVQWPDLGSLQPLPPRFKRFFCLSLQSSWDYRHAPPRPANF VFLVETGFCHVSQAGLELLTSSDPPPRPPKVLR
-
Molecular Weight
35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
E2F2 is a member of the E2F family of transcription factors, which play a crucial role in the regulation of cell cycle progression, DNA synthesis, and the maintenance of cellular proliferation. Its function is primarily associated with the control of genes required for the transition from the G1 phase to the S phase of the cell cycle. E2F2 can act both as a repressor and an activator of target genes, depending on its interactions with various proteins, such as retinoblastoma (Rb) protein and other regulatory factors. Research on E2F2 has garnered interest due to its implications in cancer biology, where dysregulation of E2F family members can lead to uncontrolled cell division and tumor progression. Studies have shown that E2F2 expression levels correlate with the growth and invasiveness of various tumors, making it a potential biomarker for cancer prognosis. Additionally, E2F2’s role in apoptosis and differentiation highlights its importance in maintaining normal cellular functions. Understanding the regulatory mechanisms governing E2F2 activity, along with its interactions with other proteins, can provide insights into novel therapeutic strategies for cancer treatment and potentially other diseases associated with cell cycle dysregulation. Moreover, research involving E2F2 may uncover its contributions to normal developmental processes and stem cell biology, further emphasizing its multifaceted role in both health and disease.
