Analytical Data
-
Gene name
CXX1
- Application
-
Alternative Names
RTL8C; CXX1; FAM127A; MAR8; MAR8C; MART8; Retrotransposon Gag-like protein 8C; Mammalian retrotransposon derived protein 8C
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A6ZKI3
-
Expression Region
1-113aa
-
AA Sequence
MDGRVQLIKALLALPIRPATRRWRNPIPFPETFDGDTDRLPEFIVQTGSYMFVDENTFSSDALKVTFLITRLTGPALQWVIPYIKKESPLLNDYRGFLAEMKRVFGWEEDEDF
-
Molecular Weight
39.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CXX1, also known as Chemokine CXC motif ligand 1, is a crucial protein in the human immune system, primarily involved in the recruitment and activation of neutrophils during inflammatory responses. The study of CXX1 has gained significant attention due to its pivotal role in various pathological conditions, including cancer, chronic inflammation, and infectious diseases. Elevated levels of CXX1 have been observed in tumor microenvironments, suggesting its involvement in tumor progression and metastasis. Researchers have been investigating CXX1 as a potential biomarker for cancer diagnosis and a therapeutic target for modulating inflammatory responses. Recombinant CXX1 proteins are being developed to better understand its structure-function relationship and to elucidate the mechanisms underlying its activity. This research is vital for the development of CXX1-based therapies that could enhance immune response in infections or inhibit excessive inflammation in chronic diseases. Additionally, the recombinant protein can be used in therapeutic applications, such as improving wound healing or managing autoimmune disorders, making it a significant focus in both fundamental and translational research. Overall, the exploration of CXX1’s biochemical properties and its role in disease pathophysiology holds promise for future therapeutic innovations in immunology and oncology.
