Analytical Data
-
Gene name
E2F3
- Application
-
Alternative Names
E2F3；KIAA0075；Transcription factor E2F3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00716
-
Expression Region
1-133aa
-
AA Sequence
MQSGGGVKTDDTSTLNSLCGYAWVYVWEEKQRCRLSSFFSSSASIPGLLP SHTLDLVQNVGVVLDEALGWGRERELCVKCLLEMHCGVFSCMGNHLCQAF PHFPYLSHLVSCLCFQLCVILFASCTKLIFSKV
-
Molecular Weight
41 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
E2F3 is a member of the E2F family of transcription factors, which play critical roles in regulating the cell cycle, particularly the transition from the G1 phase to the S phase. Recent studies have highlighted E2F3's involvement not only in cell proliferation but also in differentiation and apoptosis, linking it to various developmental processes and cancer progression. Its overexpression has been associated with several malignancies, indicating that it may serve as a potential oncogene. Additionally, E2F3 operates through complex interactions with other cellular proteins, including retinoblastoma (Rb) protein, to modulate transcriptional activity. Understanding the molecular mechanisms governing E2F3's function is crucial for elucidating its contributions to tumorigenesis and for developing targeted therapies. Emerging research suggests that E2F3 could be a promising biomarker for cancer prognosis and treatment response, particularly in cancers where it is aberrantly regulated. As such, there is a growing interest in exploring E2F3's role in various diseases and its potential as a therapeutic target, which underscores the importance of continued research in this area.
