Analytical Data
-
Gene name
SLC3A1
- Application
-
Alternative Names
Amino acid transporter heavy chain SLC3A1. D2h. Neutral and basic amino acid transport protein. NBAT. Solute carrier family 3 member 1. b(0.+)-type amino acid transporter-related heavy chain. rBAT
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q07837
-
Expression Region
211-320 aa
-
AA Sequence
FIPNHTSDKHIWFQLSRTRTGKYTDYYIWHDCTHENGKTIPPNNWLSVYGNSSWHFDEVRNQCYFHQFMKEQPDLNFRNPDVQEEIKEILRFWLTKGVDGFSLDAVKFLL
-
Molecular Weight
37.73 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC3A1, also known as the solute carrier family 3 member 1, is a critical protein involved in the transport of neutral amino acids and is particularly important in the context of cellular nutrient uptake and metabolism. Mutations or dysregulation in SLC3A1 have been linked to several human diseases, including cystinuria, a genetic disorder characterized by the renal accumulation of cystine and other dibasic amino acids, leading to kidney stone formation. Research on the recombinant form of SLC3A1 has gained momentum as it provides a valuable tool for understanding the structure-function relationships of the protein and its role in amino acid transport mechanisms. By utilizing recombinant technology, researchers can produce larger quantities of SLC3A1 in various expression systems, allowing for detailed biochemical and biophysical analyses. Such studies can elucidate the mechanisms underlying the transport process, the impact of specific mutations on SLC3A1 function, and potential therapeutic targets for conditions linked to its dysfunction. Additionally, recombinant SLC3A1 can be instrumental in drug discovery processes by enabling screening for compounds that could modulate its activity. Overall, the investigation of SLC3A1 and its recombinant protein forms is essential for advancing our understanding of amino acid transport and its implications in health and disease.
