Analytical Data
-
Gene name
MFSD8
- Application
-
Alternative Names
MFSD8；CLN7；Major facilitator superfamily domain-containing Protein 8
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NHS3
-
Expression Region
1-40aa
-
AA Sequence
MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWRSIR
-
Molecular Weight
34.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MFSD8 (Major Facilitator Superfamily Domain Containing 8) is a member of the major facilitator superfamily of transporters, which are integral membrane proteins playing crucial roles in the transportation of various substrates across cellular membranes. Recent research has highlighted the importance of MFSD8 in cellular function and its involvement in specific pathological conditions. Mutations in the MFSD8 gene have been linked to lysosomal storage disorders, particularly a rare condition known as Mahvash disease, characterized by progressive neurological deficits and other systemic symptoms. These findings underline the necessity for a deeper understanding of MFSD8's structure and function. Recombinant MFSD8 protein has become a focus of investigation, as it enables researchers to study the protein's transport mechanisms, substrate specificity, and interactions with other cellular components in vitro. By producing MFSD8 in a heterologous expression system, scientists aim to elucidate its role in cellular processes and develop potential therapeutic strategies. Additionally, the characterization of MFSD8's biochemical properties can lead to insights into the molecular pathogenesis of related disorders, ultimately contributing to the development of targeted treatments. The ongoing research into MFSD8 not only enhances our understanding of lysosomal biology but also opens new avenues for drug discovery and therapeutic interventions for diseases caused by transporter dysfunctions.
