Cat: PA2000-3302

Recombinant Human MFSD8 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MFSD8

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MFSD8;CLN7;Major facilitator superfamily domain-containing Protein 8

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8NHS3

  • Expression Region

    1-40aa

  • AA Sequence

    MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWRSIR

  • Molecular Weight

    34.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MFSD8 (Major Facilitator Superfamily Domain Containing 8) is a member of the major facilitator superfamily of transporters, which are integral membrane proteins playing crucial roles in the transportation of various substrates across cellular membranes. Recent research has highlighted the importance of MFSD8 in cellular function and its involvement in specific pathological conditions. Mutations in the MFSD8 gene have been linked to lysosomal storage disorders, particularly a rare condition known as Mahvash disease, characterized by progressive neurological deficits and other systemic symptoms. These findings underline the necessity for a deeper understanding of MFSD8's structure and function. Recombinant MFSD8 protein has become a focus of investigation, as it enables researchers to study the protein's transport mechanisms, substrate specificity, and interactions with other cellular components in vitro. By producing MFSD8 in a heterologous expression system, scientists aim to elucidate its role in cellular processes and develop potential therapeutic strategies. Additionally, the characterization of MFSD8's biochemical properties can lead to insights into the molecular pathogenesis of related disorders, ultimately contributing to the development of targeted treatments. The ongoing research into MFSD8 not only enhances our understanding of lysosomal biology but also opens new avenues for drug discovery and therapeutic interventions for diseases caused by transporter dysfunctions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US