Analytical Data
-
Gene name
SLC39A14
- Application
-
Alternative Names
(LIV-1 subfamily of ZIP zinc transporter 4)(LZT-Hs4)(Solute carrier family 39 member 14)(Zrt- and Irt-like protein 14)(ZIP-14)
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15043
-
Expression Region
31-157 aa
-
AA Sequence
SSLGAPAISSFLQDLIHRYGEGDSLTLQQLKALLNHLDVGVGRGNVTQHVQGHRNLSTCFSSGDLFTAHNFSEQSRIGSSELQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSAVEVWGYG
-
Molecular Weight
20.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC39A14, also known as ZIP14, is a member of the SLC39 family of zinc transporters that plays a pivotal role in regulating cellular zinc and metal ion homeostasis. Recent studies have implicated SLC39A14 in various physiological processes, including immune function, cellular proliferation, and neuronal development. Dysregulation of this transporter has been associated with several pathological conditions, such as diabetes, neurological disorders, and certain cancers. Given its critical role in metal ion transport, the recombinant expression of SLC39A14 in a suitable host system has become a focal point of research. This enables the study of its structural properties, transport mechanisms, and interactions with other cellular components. By producing SLC39A14 in a recombinant form, researchers can elucidate its function in health and disease, providing insights into how alterations in zinc homeostasis could contribute to various diseases. Additionally, recombinant SLC39A14 serves as a valuable tool for screening potential therapeutic compounds that might modulate its activity, further underscoring its relevance in biomedical research. Understanding the mechanisms by which SLC39A14 operates could pave the way for novel interventions targeting zinc transport and its associated pathways in disease management and therapeutic development.
