Analytical Data
-
Gene name
SLC39A3
- Application
-
Alternative Names
AI845814; MGC105842; MGC109671; MGC7461; S39A3_HUMAN; SLC; Slc39a3; Solute carrier family 39 (zinc transporter). member 3; Solute carrier family 39 member 3; Zinc transporter; Zinc transporter ZIP3; ZIP-3; Zip3; Zrt and Irt like protein 3; Zrt- and Irt-like protein 3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BRY0
-
Expression Region
1-105 aa
-
AA Sequence
MVKLLVAKILCMVGVFFFMLLGSLLPVKIIETDFEKAHRSKKILSLCNTFGGGVFLATCFNALLPAVREKVRAPWALAAALGTLWPRDSDAFSTLMPSSVKALML
-
Molecular Weight
37.29 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC39A3, also known as ZIP3, is a member of the SLC39 family of zinc transporters, which play critical roles in zinc homeostasis and cellular function. Zinc is an essential micronutrient that is crucial for various biological processes, including enzyme activity, protein synthesis, and gene expression. Dysregulation of zinc transporters, including SLC39A3, has been associated with numerous health conditions, including cancer, diabetes, and neurodegenerative diseases. Understanding the structure and function of SLC39A3 is vital for elucidating its role in zinc transport and its broader implications in health and disease. The study of recombinant SLC39A3 protein facilitates detailed biochemical and biophysical analyses, allowing researchers to explore its mechanism of action, substrate specificity, and interaction with other cellular components. This knowledge could contribute to the development of therapeutic strategies targeting zinc transport pathways, thereby offering potential interventions for diseases linked to zinc dysregulation. In summary, investigating recombinant SLC39A3 provides valuable insights into the essential role of zinc homeostasis in human health and the molecular mechanisms underlying various pathologies associated with altered zinc transport.
