Analytical Data
-
Gene name
COL19
- Application
-
Alternative Names
COL19；Cuticle collagen 19
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P18835
-
Expression Region
1-289aa
-
AA Sequence
MGKLIVVGSCGVLVCVLASLYTIGNLLNEIEELQVEFQDGMVEFRAITQDTWARMVSKHINPTGHTNAPPTFETLFGARTARQAGFEQCNCGPKSEGCPAGPPGPPGEGGQKGNPGHDGDDGKPGAPGVIVAITHDIPGGCIKCPPGRPGPKGPSGLPGSAGPAGGNGRRGPPGPVGGPGEQGPQGDAGRPGAAGRPGPAGPRGEPGTEYKPGQPGRPGPQGPRGETGPAGNPGAPGNDGEAGKNGNAGRPGPPGHPGKNGVPGQKGEDAAPGPDAGYCPCPSRAAYKA
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COL19 is a type of collagen, specifically known as collagen type XIX, which is classified as an interstitial collagen predominantly found in various tissues such as skin, cartilage, and tendons. The significance of COL19 lies in its involvement in extracellular matrix (ECM) structure and function, playing a crucial role in tissue integrity, cellular signaling, and development. Recent studies have indicated that COL19 may be implicated in various pathological conditions, including fibrosis and certain types of cancer, where its expression levels are altered. Researchers have shown an increasing interest in recombinant COL19 proteins due to their potential applications in tissue engineering and regenerative medicine. The generation of recombinant COL19 proteins allows for the detailed study of their biochemical properties, interactions with other ECM components, and functional roles in biological processes. Furthermore, understanding the structure-function relationships of COL19 may unveil new therapeutic strategies for diseases where ECM remodeling is a critical factor. By optimizing expression systems and purification methods for COL19 recombinant proteins, scientists aim to expand the knowledge of its biological significance and harness its therapeutic potential, paving the way for innovations in ECM-based therapies and treatment options for various pathological conditions.
