Analytical Data
-
Gene name
SLC36A2
- Application
-
Alternative Names
SLC36A2; PAT2; TRAMD1; Proton-coupled amino acid transporter 2; Proton/amino acid transporter 2; Solute carrier family 36 member 2; Tramdorin-1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q495M3
-
Expression Region
1-285 aa
-
AA Sequence
MDSRLYMLSFLPFLVLLVLIRNLRILTIFSMLANISMLVSLVIIIQYITQEIPDPSRLPLVASWKTYPLFFGTAIFSFESIGVVLPLENKMKNARHFPAILSLGMSIVTSLYIGMAALGYLRFGDDIKASISLNLPNCWLYQSVKLLYIAGILCTYALQFYVPAEIIIPFAISRVSTRWALPLDLSIRLVMVCLTCLLAILIPRLDLVISLVGSVSGTALALIIPPLLEVTTFYSEGMSPLTIFKDALISILGFVGFVVGTYQALDELLKSEDSHPFSNSTTFVR
-
Molecular Weight
58 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC36A2, a member of the solute carrier family, encodes a proton-coupled amino acid transporter primarily involved in the absorption of neutral amino acids in the intestine and their reabsorption in the kidneys. Its significance is underscored by its association with human health, particularly in cases of neurological disorders linked to amino acid imbalances. Recent studies have highlighted SLC36A2's role in neurotransmitter regulation, affecting conditions such as autism spectrum disorders and developmental delays. Understanding its structure and function through the generation and analysis of recombinant SLC36A2 protein can provide vital insights into its transport mechanisms and physiological roles. Such research is crucial for developing therapeutic strategies targeting amino acid transport dysregulation in various diseases. Moreover, investigating the functional dynamics of this protein can unveil potential interactions with pharmacological agents, thereby enhancing our comprehension of its contribution to cellular homeostasis and overall metabolic health. Therefore, the study of SLC36A2 recombinant protein becomes essential for both elucidating fundamental biological processes and informing clinical approaches to related disorders.
