Analytical Data
-
Gene name
ABCC4
- Application
-
Alternative Names
ABCC4；MOATB；MRP4；ATP-binding cassette sub-family C member 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15439
-
Expression Region
1-110aa
-
AA Sequence
MLPVYQEVKPNPLQDANLCSRVFFWWLNPLFKIGHKRRLEEDDMYSVLPE DRSQHLGEELQGFWDKEVLRAENDAQKPSLTRAIIKCYWKSYLVLGIFTL IEESAKVIQP
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ABCC4, also known as Multidrug Resistance-Associated Protein 4 (MRP4), is an ATP-binding cassette (ABC) transporter that plays a crucial role in cellular transport processes, particularly in the efflux of various metabolites, drugs, and signaling molecules across cellular membranes. Its significance in pharmacokinetics, drug resistance, and various disease states, such as cancer and cardiovascular disorders, has drawn considerable attention in research. Overexpression of ABCC4 has been linked to the multidrug resistance phenotype in tumor cells, making it a potential target for overcoming therapeutic resistance. Additionally, ABCC4 is involved in the transportation of cyclic nucleotides and certain neurotransmitters, indicating its impact on cellular signaling pathways. The study of recombinant ABCC4 protein aims to elucidate its structural and functional characteristics, providing insights into its role in drug transport mechanisms and potential therapeutic strategies. By producing recombinant ABCC4, researchers can investigate its interaction with various substrates, assess the impact of mutations on its function, and explore its pharmacological implications. Understanding the molecular basis of ABCC4's activity could lead to the development of novel treatments that mitigate drug resistance and enhance the efficacy of existing therapies.
