Analytical Data
-
Gene name
RNF125
- Application
-
Alternative Names
RNF125；E3 ubiquitin-Protein ligase RNF125
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96EQ8
-
Expression Region
1-232aa
-
AA Sequence
MGSVLSTDSGKSAPASATARALERRRDPELPVTSFDCAVCLEVLHQPVRTRCGHVFCRSCIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDTLVCLSEMRAHIRTCQKYIDKYGPLQELEETAARCVCPFCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNHSNTT
-
Molecular Weight
53.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RNF125, a member of the RBR E3 ubiquitin ligase family, plays a critical role in various cellular processes, including protein degradation, signal transduction, and immune response modulation. Emerging evidence suggests that RNF125 is involved in the regulation of key oncogenic pathways, making it a significant focus in cancer research. Specifically, RNF125 has been implicated in the degradation of several proteins associated with tumor progression and metastasis. Studies have demonstrated that RNF125 can influence the stability of oncogenes and tumor suppressor genes, highlighting its potential as a therapeutic target. Additionally, RNF125 has been shown to participate in the innate immune response, particularly in regulating the antiviral response by modulating pathways such as those activated by interferons. Given its multifaceted roles, understanding the mechanisms governing RNF125 activity and its interactions with other cellular components can pave the way for novel therapeutic strategies in cancer and immune-related disorders. Researchers are now focusing on developing RNF125-targeted therapies, aiming to harness its E3 ligase activity for drug development and to explore its potential as a biomarker for disease progression. Overall, the study of RNF125 not only enhances our comprehension of cellular signaling mechanisms but also opens new avenues for targeted interventions in malignancies and immune disorders.
