Analytical Data
-
Gene name
CTDSPL2
- Application
-
Alternative Names
CTD (carboxy-terminal domain; RNA polymerase II; polypeptide A) small phosphatase like 2; CTD small phosphatase like 2; CTD small phosphatase like protein 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q05D32
-
Expression Region
1-466aa
-
AA Sequence
MRLRTRKASQQSNQIQTQRTARAKRKYSEVDDSLPSGGEKPSKNETGLLSSIKKFIKGSTPKEERENPSKRSRIERDIDNNLITSTPRAGEKPNKQISRVRRKSQVNGEAGSYEMTNQHVKQNGKLEDNPSSGSPPRTTLLGTIFSPVFNFFSPANKNGTSGSDSPGQAVEAEEIVKQLDMEQVDEITTSTTTSTNGAAYSNQAVQVRPSLNNGLEEAEETVNRDIPPLTAPVTPDSGYSSAHAEATYEEDWEVFDPYYFIKHVPPLTEEQLNRKPALPLKTRSTPEFSLVLDLDETLVHCSLNELEDAALTFPVLFQDVIYQVYVRLRPFFREFLERMSQMYEIILFTASKKVYADKLLNILDPKKQLVRHRLFREHCVCVQGNYIKDLNILGRDLSKTIIIDNSPQAFAYQLSNGIPIESWFMDKNDNELLKLIPFLEKLVELNEDVRPHIRDRFRLHDLLPPD
-
Molecular Weight
79.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CTDSPL2, or C-Terminal Domain of RNA Polymerase II Specific Phosphatase-Like 2, is a member of the phosphatase family that plays a crucial role in regulating various cellular processes, including transcription and RNA processing. Given the importance of RNA polymerase II in gene expression, understanding CTDSPL2 and its function could yield significant insights into cellular signaling pathways and disease mechanisms. Recent studies have indicated that alterations in phosphatase activity can contribute to the progression of several diseases, particularly cancers, through dysregulation of gene expression. Moreover, CTDSPL2 has been identified as having a potential role in the dephosphorylation of the C-terminal domain of RNA polymerase II, which is vital for transcriptional regulation. This positions CTDSPL2 as a potential target for therapeutic interventions aimed at correcting transcriptional dysregulation. Despite its significance, the functional mechanisms of CTDSPL2 remain not fully understood; hence, research focused on its recombinant protein is essential for elucidating its biochemical properties and interactions. By studying the recombinant CTDSPL2 protein, researchers aim to unravel its structural characteristics and functional dynamics, contributing to a broader understanding of its role in transcriptional regulation and potential involvement in human diseases. Overall, advancing knowledge in this area could pave the way for novel strategies in disease treatment and elucidate fundamental biological processes governed by post-translational modifications.
