Analytical Data
-
Gene name
ABCC8
- Application
-
Alternative Names
ABCC8；HRINS；SUR；SUR1；ATP-binding cassette sub-family C member 8
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q09428
-
Expression Region
611-710aa
-
AA Sequence
SEFLSSAEIREEQCAPHEPTPQGPASKYQAVPLRVVNRKRPAREDCRGLT GPLQSLVPSADGDADNCCVQIMGGYFTWTPDGIPTLSNITIRIPRGQLTM
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ABCC8, also known as the ATP-binding cassette sub-family C member 8, plays a crucial role in the regulation of insulin secretion from pancreatic beta cells. Mutations in the ABCC8 gene can lead to congenital hyperinsulinism, a condition characterized by excessive insulin production, which may result in severe hypoglycemia in affected individuals. Given its pivotal function in glucose metabolism and insulin regulation, research on ABCC8 recombinant protein has significant implications for understanding diabetes and related disorders. The development of recombinant ABCC8 protein enables detailed studies of its structure, function, and interaction with other cellular components crucial for insulin secretion. Additionally, characterizing this protein can help identify potential therapeutic targets for conditions arising from ABCC8 dysfunction. Through advanced techniques such as crystallography and binding assays, researchers can ascertain how mutations affect ABCC8's function and subsequently develop strategies to mitigate the adverse effects associated with its abnormalities. Understanding the mechanistic pathways involving ABCC8 not only contributes to our knowledge of endocrine function but also paves the way for the development of novel treatments for hyperinsulinism and diabetes, thereby addressing a significant public health concern.
