Cat: PA2000-3260

Recombinant Human Serpina3n Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Serpina3n

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Serpina3n;Spi2;Serine protease inhibitor A3N

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P29508

  • Expression Region

    1-390aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMNSLSEANTKFMFDLFQQFRKSKENNI FYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDR SGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFY QTSESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLNA IYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQA KVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETR VDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVL HKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTN SILFYGRFSSP

  • Molecular Weight

    47 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Serpina3n, a member of the serine proteinase inhibitors (serpins) family, has garnered significant attention in biomedical research due to its potential roles in various physiological and pathological processes. Originally identified for its involvement in the regulation of inflammation and immune responses, Serpina3n has been linked to multiple diseases, including cancer, neurodegenerative disorders, and cardiovascular diseases. Its ability to inhibit serine proteases implies a crucial function in maintaining homeostasis within the extracellular environment. Researchers are particularly interested in understanding the structural and functional properties of recombinant Serpina3n, as these insights could lead to the development of novel therapeutic strategies. Recombinant protein expression systems allow for the production of Serpina3n in a controlled manner, enabling detailed studies on its activity, interaction with target proteases, and potential applications in drug design. By elucidating the mechanisms through which Serpina3n exerts its effects, scientists hope to uncover new biomarkers for disease progression and develop targeted interventions that leverage its inhibitory functions. This research is further supported by advances in proteomics and structural biology, which facilitate the exploration of Serpina3n's complex interactions and regulatory networks within the body. Overall, the study of Serpina3n as a recombinant protein offers promising avenues for enhancing our understanding of its biological significance and therapeutic potential.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US