Analytical Data
-
Gene name
CT45-4
- Application
-
Alternative Names
CT45A3; CT45-3; CT45-4; CT45A4Cancer/testis antigen family 45 member A3; Cancer/testis antigen 45-3; Cancer/testis antigen 45-4; Cancer/testis antigen 45A3; Cancer/testis antigen 45A4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NHU0
-
Expression Region
1-189aa
-
AA Sequence
MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKAKKLMTGHAIPPSQLDSQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQQEINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI
-
Molecular Weight
47.19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CT45-4 is a member of the cancer-testis (CT) antigen family, which is primarily expressed in human germ cells and various cancerous tissues, making it a promising target for immunotherapy. The identification of CT45-4 as a tumor-specific protein has garnered interest due to its restricted expression pattern, which suggests it may provoke an immune response in cancer patients while sparing normal tissues. Research has shown that CT45-4 is associated with several malignancies, including melanoma and testicular cancer, leading to its potential as a biomarker for cancer diagnosis and prognosis. The understanding of its mechanism of action, presentation on MHC molecules, and the types of immune responses it elicits are key subjects of ongoing investigations. Moreover, CT45-4 is being studied to develop therapeutic vaccines and adoptive T cell therapies aimed at enhancing the body's immune response against tumors expressing this antigen. As such, CT45-4 not only presents a novel focus for targeted cancer immunotherapy but also enhances our understanding of tumor immunology and the potential for harnessing the immune system in combatting cancer. This makes CT45-4 a significant subject of interest within cancer research, particularly in the fields of immuno-oncology and cancer vaccine development.
