Analytical Data
-
Gene name
SLC25A21
- Application
-
Alternative Names
SLC25A21; ODC; Mitochondrial 2-oxodicarboxylate carrier; Solute carrier family 25 member 21
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BQT8
-
Expression Region
1-299 aa
-
AA Sequence
MSAKPEVSLVREASRQIVAGGSAGLVEICLMHPLDVVKTRFQIQRCATDPNSYKSLVDSFRMIFQMEGLFGFYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALTFAIAGLGSGLTEAIVVNPFEVVKVGLQANRNTFAEQPSTVGYARQIIKKEGWGLQGLNKGLTATLGRHGVFNMVYFGFYYNVKNMIPVNKDPILEFWRKFGIGLLSGTIASVINIPFDVAKSRIQGPQPVPGEIKYRTCFKTMATVYQEEGILALYKGLLPKIMRLGPGGAVMLLVYEYTYSWLQENW
-
Molecular Weight
59.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC25A21, a member of the solute carrier family, encodes a mitochondrial carrier protein involved in the transport of metabolites across the mitochondrial membrane. This protein plays a crucial role in mitochondrial function, specifically in the transport of key substances such as carnitine, which is vital for fatty acid metabolism and energy production. Mutations in the SLC25A21 gene have been associated with various metabolic disorders, highlighting its importance in cellular energy homeostasis. Research on recombinant SLC25A21 protein aims to elucidate its structure-function relationships and transport mechanisms, providing insights into its physiological roles and the consequences of its dysfunction. By expressing and characterizing this protein in heterologous systems, scientists can study its properties in detail, paving the way for potential therapeutic strategies to address conditions linked to SLC25A21 impairment. Such studies may also enhance our understanding of mitochondrial biology and its implications in human health and disease.
