Analytical Data
-
Gene name
SLC25A17
- Application
-
Alternative Names
SLC25A17; PMP34; Peroxisomal membrane protein PMP34; 34 kDa peroxisomal membrane protein; Solute carrier family 25 member 17
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43808
-
Expression Region
1-307 aa
-
AA Sequence
MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYRGWFPVISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKDLVVGFVAGVVNVLLTTPLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGISALWNGTFPSLLLVFNPAIQFMFYEGLKRQLLKKRMKLSSLDVFIIGAVAKAIATTVTYPLQTVQSILRFGRHRLNPENRTLGSLRNILYLLHQRVRRFGIMGLYKGLEAKLLQTVLTAALMFLVYEKLTAATFTVMGLKRAHQH
-
Molecular Weight
59.51 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC25A17 is a member of the solute carrier family 25, which plays a crucial role in the transport of metabolites across mitochondrial membranes. The protein is primarily involved in the transport of pyrimidines, such as uridine and cytidine, which are essential for RNA synthesis and cellular metabolism. Deficiencies in SLC25A17 have been linked to various metabolic disorders, highlighting its significance in maintaining cellular homeostasis and mitochondrial function. Research into SLC25A17 recombinant proteins has gained momentum due to their potential applications in understanding mitochondrial diseases and providing insights into cellular energetic metabolism. By producing and characterizing SLC25A17 recombinant proteins, scientists aim to elucidate the molecular mechanisms underlying mitochondrial transport processes, assess the impact of genetic mutations on transport efficiency, and explore potential therapeutic avenues for conditions associated with SLC25A17 dysfunction. Additionally, studying these recombinant proteins allows for the development of high-throughput assays and screening methods that could lead to novel drug discoveries targeting mitochondrial-related pathways. Understanding the full spectrum of SLC25A17's functional role is essential for developing strategies to mitigate the effects of related diseases, making it a pivotal focus of current mitochondrial research.
