Analytical Data
-
Gene name
CRTAC1
- Application
-
Alternative Names
68 kDa chondrocyte expressed protein; 68 kDa chondrocyte-expressed protein; Acidic secreted protein in cartilage; ASPIC; ASPIC1; Cartilage acidic protein 1; Cartilage acidic protein 1 precursor; CEP 68 ; CEP-68; CEP68
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NQ79
-
Expression Region
1-451aa
-
AA Sequence
MDPEASDLSRGILALRDVAAEAGVSKYTGGRGVSVGPILSSSASDIFCDNENGPNFLFHNRGDGTFVDAAASAGVDDPHQHGRGVALADFNRDGKVDIVYGNWNGPHRLYLQMSTHGKVRFRDIASPKFSMPSPVRTVITADFDNDQELEIFFNNIAYRSSSANRLFRVIRREHGDPLIEELNPGDALEPEGRGTGGVVTDFDGDGMLDLILSHGESMAQPLSVFRGNQGFNNNWLRVVPRTRFGAFARGAKVVLYTKKSGAHLRIIDGGSGYLCEMEPVAHFGLGKDEASSVEVTWPDGKMVSRNVASGEMNSVLEILYPRDEDTLQDPAPLECGQGFSQQENGHCMDTNECIQFPFVCPRDKPVCVNTYGSYRCRTNKKCSRGYEPNEDGTACVGTLGQSPGPRPTTPTAAAATAAAAAAAGAATAAPVLVDGDLNLGSVVKESCEPSC
-
Molecular Weight
74.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CRTAC1 (cartilage acidic protein 1) is a key extracellular matrix protein primarily expressed in cartilage and is implicated in various biological processes, including chondrogenesis, inflammation, and tissue repair. The study of CRTAC1 recombinant protein has gained attention due to its potential role in cartilage development and its association with degenerative joint diseases such as osteoarthritis. Researchers are focusing on understanding the molecular mechanisms by which CRTAC1 influences chondrogenic differentiation and extracellular matrix organization. The recombinant form of CRTAC1 allows for detailed investigations into its structure-function relationships, providing insights into its interactions with other matrix components, which are critical for maintaining cartilage homeostasis. Additionally, evaluating CRTAC1's functionality in vitro and in vivo can pave the way for novel therapeutic strategies targeting cartilage regeneration and repair. As research progresses, CRTAC1 recombinant protein may offer valuable biomolecular tools for elucidating the pathophysiological mechanisms underlying cartilage-related disorders, leading to improved diagnostic and therapeutic options.
