Analytical Data
-
Gene name
SLC22A4
- Application
-
Alternative Names
Ergothioneine transporter;ET transporter;Organic cation/carnitine transporter 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H015
-
Expression Region
42-141 aa
-
AA Sequence
LAGTPEHRCRVPDNLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK
-
Molecular Weight
18.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC22A4, a member of the solute carrier family, encodes a protein that functions as a transporter for various organic cations, including drugs and metabolites. It is primarily expressed in tissues such as the kidney, liver, and immune cells, indicating its role in drug absorption and elimination as well as immune system regulation. Variations in the SLC22A4 gene, including single nucleotide polymorphisms, have been associated with several diseases, particularly autoimmune conditions like rheumatoid arthritis and Crohn's disease. Understanding the biological mechanisms of SLC22A4 through recombinant protein studies is crucial for elucidating its functional properties and interactions with substrates. Moreover, studying the recombinant protein may reveal how genetic variants affect its transport capacity, stability, and overall function. This knowledge could lead to novel therapeutic strategies that target SLC22A4 in disease management and personalized medicine, highlighting the importance of detailed research into the structure and function of SLC22A4 as a critical player in the pharmacogenomics landscape.











