Analytical Data
-
Gene name
Dock8
- Application
-
Alternative Names
Dock8；Dedicator of cytokinesis Protein 8
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NF50
-
Expression Region
560-729aa
-
AA Sequence
RNLLYVYPQRLNFVNKLASARNITIKIQFMCGEDASNAMPVIFGKSSGPE FLQEVYTAVTYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQG ASVETLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPLQN PPIKWAEGHKGVFNIEVQAV
-
Molecular Weight
22 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Dock8 is a member of the Dedicator of Cytokinesis (DOCK) family of proteins, functioning primarily as a guanine nucleotide exchange factor (GEF) for Rac GTPases. It plays a crucial role in immune responses, particularly in the activation and migration of various immune cells, including T cells and natural killer (NK) cells. Mutations or deficiencies in Dock8 have been linked to severe combined immunodeficiency (SCID), characterized by a heightened susceptibility to infections, autoimmune disorders, and an increased risk of malignancies. Research into Dock8 is vital for understanding the molecular mechanisms underlying immune system function and dysfunction. Current studies focus on elucidating the signaling pathways regulated by Dock8, its interactions with other proteins, and its role in rearranging the actin cytoskeleton during immune cell activation. Furthermore, the exploration of Dock8 as a therapeutic target offers promising avenues for developing interventions that could enhance immune responses in individuals with immune deficiencies or enhance anti-tumor immunity. As such, Dock8 represents a significant focus area in immunology research, with implications for both basic science and clinical applications.
