Analytical Data
-
Gene name
CRI1
- Application
-
Alternative Names
EP300-interacting inhibitor of differentiation 1. 21 kDa pRb-associated protein. CREBBP/EP300 inhibitory protein 1. E1A-like inhibitor of differentiation 1. EID-1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y6B2
-
Expression Region
1-187aa
-
AA Sequence
MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE
-
Molecular Weight
47.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The CRI1 (Cooling Reliant Interactor 1) recombinant protein has garnered significant attention in recent years due to its potential implications in plant stress response and adaptation mechanisms. This protein plays a crucial role in the regulation of physiological processes related to plant resilience under various environmental stressors, such as drought, salinity, and extreme temperatures. Understanding the structure and function of CRI1 is vital for advancing our knowledge of plant biology, particularly in the context of improving crop yields in a changing climate. Researchers have utilized recombinant DNA technology to produce CRI1 in various host systems, enabling the study of its biochemical properties and interaction networks. By analyzing CRI1's molecular function, scientists aim to unravel the signaling pathways involved in stress response, which could lead to the development of genetically modified crops with enhanced stress tolerance. Additionally, CRI1 may serve as a valuable tool in biotechnological applications, assisting in the creation of innovative agricultural solutions to meet the increasing demands for food security. Overall, the exploration of CRI1 recombinant protein represents a promising frontier in plant molecular research, with the potential to contribute significantly to sustainable agricultural practices and climate resilience.











