Analytical Data
-
Gene name
SLC22A1LS
- Application
-
Alternative Names
Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene B protein. Organic cation transporter-like protein 2 antisense protein. Solute carrier family 22 member 1-like antisense protein. Solute carrier family 22 member 18 antisense protein. p27-Beckwith-Wiedemann region 1 B. p27-BWR1B
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N1D0
-
Expression Region
1-150 aa
-
AA Sequence
MRCAEGAWWFSPDGPAGSAASIWPAEGAEGLPGQLGRDRLEVVYSVPDNVPGQNGSRRPLVCKITGKCLSVCSEENAKAGGCSAFPLLLSQLGARMTGREHAHKGPELTTPDSGLPRPPNPALAGFRALAQHSPPLGTSTPSAVLLSAAT
-
Molecular Weight
41.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC22A1 (Solute Carrier Family 22 Member 1), also known as OCT1 (Organic Cation Transporter 1), is a critical membrane protein involved in the transport of organic cations, including various drugs and endogenous compounds, across cell membranes. Research into the recombinant expression of SLC22A1 has gained significant attention due to its pivotal role in pharmacogenomics and drug metabolism. Variations in the SLC22A1 gene impact the transport efficiency and pharmacokinetics of numerous therapeutics, which can result in variable drug responses among individuals. Recombinant SLC22A1 proteins are essential for studying the functional properties of this transporter, enabling insights into substrate specificity, transport mechanisms, and the effects of genetic polymorphisms. Understanding these factors is crucial for optimizing drug therapies and developing personalized medicine approaches. Additionally, the study of SLC22A1 may provide valuable information regarding drug-drug interactions and toxicity, as many clinically relevant drugs are substrates of this transporter. By producing and characterizing recombinant SLC22A1 proteins, researchers can advance our understanding of its biological roles and therapeutic implications, ultimately contributing to improved drug efficacy and safety profiles in clinical settings.
