Analytical Data
-
Gene name
CREB3
- Application
-
Alternative Names
CREB3; LZIP; Cyclic AMP-responsive element-binding protein 3; CREB-3; cAMP-responsive element-binding protein 3; Leucine zipper protein; Luman; Transcription factor LZIP-alpha
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43889
-
Expression Region
1-371aa
-
AA Sequence
MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAIYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG
-
Molecular Weight
67.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CREB3 (cAMP response element-binding protein 3) is a transcription factor that plays a critical role in various physiological processes, including cellular stress response, metabolism, and development. It belongs to the family of CREB/ATF proteins and is primarily involved in the regulation of gene expression in response to cellular signals. Recent studies have highlighted the importance of CREB3 in endoplasmic reticulum (ER) stress and the unfolded protein response (UPR), which are vital for maintaining cellular homeostasis. Dysregulation of CREB3 has been implicated in various diseases, including cancer and neurodegenerative disorders, making it a significant target for therapeutic research. Recombinant CREB3 proteins have emerged as valuable tools for investigating its functional mechanisms, allowing researchers to study the effects of specific mutations, post-translational modifications, and interactions with other cellular components. Understanding the role of CREB3 through recombinant protein studies could provide insights into its contribution to disease pathogenesis and identify potential strategies for intervention. Given its central role in cell signaling pathways, the recombinant expression of CREB3 and its derivatives in heterologous systems can aid in elucidating the complex regulatory networks it operates within, paving the way for novel therapeutic approaches that harness the potential of this important transcription factor.
