Analytical Data
-
Gene name
HTR2C
- Application
-
Alternative Names
HTR2C；HTR1C；5-hydroxytryptamine receptor 2C
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P28335
-
Expression Region
1-52aa
-
AA Sequence
MVNLRNAVHSFLVHLIGLLVWQSDISVSPVAAIVTDIFNTSDGGRFKFPD GV
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The HTR2C gene encodes the serotonin receptor 2C, a G-protein coupled receptor that plays a crucial role in various physiological processes, including mood regulation, appetite control, and anxiety response. This receptor has garnered significant interest in neuroscience and pharmacology due to its association with several neuropsychiatric disorders, such as depression, schizophrenia, and obesity. HTR2C's unique splice variants and regulatory mechanisms further complicate its functional implications, making it a valuable target for therapeutic intervention. The research surrounding HTR2C recombinant protein focuses on understanding its structure and function, enabling the exploration of ligand-binding properties and intracellular signaling pathways. Characterizing the HTR2C protein through recombinant expression systems facilitates the development of specific modulators, which could enhance the efficacy and safety profiles of existing treatments for related disorders. Furthermore, assessing HTR2C interactions with various pharmacological agents provides insights into receptor behavior and potential drug targets, paving the way for novel therapeutic strategies. The investigation of HTR2C also extends to its role in metabolic processes, thereby linking mental health with metabolic regulation, which is particularly relevant in the context of rising obesity rates globally. Overall, HTR2C recombinant protein studies are pivotal in advancing our understanding of serotonin signaling and its broader implications in health and disease.
