Cat: PA1000-7621

Recombinant Human HTR2C Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HTR2C

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HTR2C;HTR1C;5-hydroxytryptamine receptor 2C

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P28335

  • Expression Region

    1-52aa

  • AA Sequence

    MVNLRNAVHSFLVHLIGLLVWQSDISVSPVAAIVTDIFNTSDGGRFKFPD GV

  • Molecular Weight

    31 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The HTR2C gene encodes the serotonin receptor 2C, a G-protein coupled receptor that plays a crucial role in various physiological processes, including mood regulation, appetite control, and anxiety response. This receptor has garnered significant interest in neuroscience and pharmacology due to its association with several neuropsychiatric disorders, such as depression, schizophrenia, and obesity. HTR2C's unique splice variants and regulatory mechanisms further complicate its functional implications, making it a valuable target for therapeutic intervention. The research surrounding HTR2C recombinant protein focuses on understanding its structure and function, enabling the exploration of ligand-binding properties and intracellular signaling pathways. Characterizing the HTR2C protein through recombinant expression systems facilitates the development of specific modulators, which could enhance the efficacy and safety profiles of existing treatments for related disorders. Furthermore, assessing HTR2C interactions with various pharmacological agents provides insights into receptor behavior and potential drug targets, paving the way for novel therapeutic strategies. The investigation of HTR2C also extends to its role in metabolic processes, thereby linking mental health with metabolic regulation, which is particularly relevant in the context of rising obesity rates globally. Overall, HTR2C recombinant protein studies are pivotal in advancing our understanding of serotonin signaling and its broader implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US