Analytical Data
-
Gene name
HTR4
- Application
-
Alternative Names
HTR4；5-hydroxytryptamine receptor 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13639
-
Expression Region
1-388aa
-
AA Sequence
MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The HTR4 gene encodes the 5-hydroxytryptamine receptor 4 (5-HT4R), a member of the serotonin receptor family, which is a G protein-coupled receptor involved in various physiological processes including mood regulation, gastrointestinal motility, and cognition. Research on HTR4 has gained momentum due to its potential implications in several neuropsychiatric disorders such as depression, anxiety, and Alzheimer's disease. The receptor’s involvement in the serotonergic system makes it a critical target for drug development, particularly in designing selective agonists or antagonists to modulate serotonin signaling. Moreover, HTR4's unique expression pattern in the brain and peripheral tissues highlights its role in both central and peripheral nervous system functions. The recombinant expression of HTR4 protein provides a valuable tool for studying its structure, function, and interactions with ligands. Using techniques such as X-ray crystallography and nuclear magnetic resonance spectroscopy, researchers aim to elucidate the detailed mechanisms of HTR4 signaling pathways. Furthermore, the availability of recombinant HTR4 can facilitate high-throughput screening of compounds that could lead to new therapeutic agents for related disorders. Understanding this receptor's pharmacology and biology could pave the way for innovative treatments, reinforcing the significance of HTR4 in neurobiology and therapeutics.
