Cat: PA2000-3195

Recombinant Human IGFL1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IGFL1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IGFL1;Insulin growth factor-like family member 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q6UW32

  • Expression Region

    25-110aa

  • AA Sequence

    APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS

  • Molecular Weight

    38.7 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IGFL1 (Insulin-like Growth Factor-Like 1) is a member of the insulin-like growth factor family, which plays a crucial role in growth and development by mediating various cellular processes such as proliferation, differentiation, and apoptosis. This protein has garnered attention due to its potential implications in both physiological and pathological conditions, including muscle hypertrophy, cancer, and metabolic diseases. The study of recombinant IGFL1 has become increasingly important as it provides a means to understand its biological functions and therapeutic potential. By expressing IGFL1 in a recombinant system, researchers can obtain sufficient quantities for rigorous analysis, including binding studies and functional assays. Additionally, recombinant IGFL1 allows for the exploration of its interactions with other growth factors and receptors, shedding light on its role in signaling pathways. Understanding these mechanisms may lead to novel therapeutic strategies for conditions where IGFL1 is implicated. Furthermore, the investigation of IGFL1 can contribute to the development of biomarker diagnostics and targeted treatments for diseases such as cancer, where its altered expression may signify disease progression or therapeutic response. Overall, the research on recombinant IGFL1 not only enhances our understanding of fundamental biological processes but also opens new avenues for clinical applications in regenerative medicine and oncology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US