Analytical Data
-
Gene name
SLC10A1
- Application
-
Alternative Names
Cell growth-inhibiting gene 29 protein;Sodium/taurocholate cotransporting polypeptide;NTCP;Solute carrier family 10 member 1;SLC10A1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14973
-
Expression Region
1-349 aa
-
AA Sequence
MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA
-
Molecular Weight
39.5 kDa kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SLC10A1, also known as the sodium-dependent bile acid transporter, plays a crucial role in the enterohepatic circulation of bile acids, which are essential for lipid absorption and metabolism. It is primarily located in the proximal small intestine and facilitates the reabsorption of bile acids from the intestinal lumen back into the enterocytes, thus preventing their excessive loss through the feces. Dysfunction or mutations in the SLC10A1 gene can lead to various metabolic disorders, such as cholestasis and bile acid malabsorption, underscoring its importance in maintaining bile acid homeostasis. The study of SLC10A1 recombinant proteins allows researchers to investigate the transport mechanism at a molecular level, assess its interaction with different ligands, and explore potential therapeutic targets for related diseases. Furthermore, understanding the structure-function relationship of the SLC10A1 protein can provide insights into drug development for conditions associated with bile acid dysregulation. By employing techniques like protein expression, purification, and functional assays, researchers aim to elucidate the biological significance of SLC10A1, contributing to the broader field of transport biology and its implications for human health.
